PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0771s0019.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 394aa    MW: 43630.9 Da    PI: 8.0988
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0771s0019.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.46.1e-3372130160
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                          ldDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  +++++ei+Y+g+Hnh+k
  Kalax.0771s0019.2.p  72 LDDGYNWRKYGQKSVKGSENPRSYYKCTFTNCPTKKKVERSL-EGHITEIVYKGSHNHPK 130
                          59****************************************.***************85 PP

2WRKY106.41.5e-33227285159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d k v++tYeg+Hnh+
  Kalax.0771s0019.2.p 227 LDDGYRWRKYGQKVVKGNPNPRSYYKCTFVGCPVRKHVERASQDLKSVITTYEGKHNHD 285
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.65267131IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.8E-2868131IPR003657WRKY domain
SuperFamilySSF1182905.36E-2570131IPR003657WRKY domain
SMARTSM007741.5E-3572130IPR003657WRKY domain
PfamPF031068.9E-2573129IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-37212287IPR003657WRKY domain
SuperFamilySSF1182903.14E-29219287IPR003657WRKY domain
PROSITE profilePS5081137.654222287IPR003657WRKY domain
SMARTSM007742.4E-38227286IPR003657WRKY domain
PfamPF031061.0E-25228285IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MCDKPCCEQD DTMSKQLEWS FNTHPKQTDL SSNVIQTVAQ AESRPMQTNS NMQNGTAVAS  60
SRSNMGGKQR RLDDGYNWRK YGQKSVKGSE NPRSYYKCTF TNCPTKKKVE RSLEGHITEI  120
VYKGSHNHPK PQSTRRSSSS SLYGCCESEN GHTESGGTPE NSSTSMGEDE FEHGSPLSKS  180
GDDNDVNEPD SKRWKGENEI ESAAGSGSRT VREPRIVVQT TSEIDILDDG YRWRKYGQKV  240
VKGNPNPRSY YKCTFVGCPV RKHVERASQD LKSVITTYEG KHNHDVPAAR GSHSYSMIKP  300
SSSANAPLAI RPTAATVSSA NHTSNYSNSL QASRPSTQAP FTLEMMQDPG SFGFSGFGKP  360
SCNYGSQPQM DSFFSRAKEE PKDDQFFFDQ FLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-3772288878Probable WRKY transcription factor 4
2lex_A2e-3772288878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007026547.11e-147RNI-like superfamily protein
SwissprotQ8S8P51e-120WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A061EXQ11e-147A0A061EXQ1_THECC; RNI-like superfamily protein
TrEMBLA0A140H8N11e-155A0A140H8N1_MANES; WRKY transcription factor 27
STRINGVIT_08s0058g00690.t011e-141(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-118WRKY DNA-binding protein 33